DPCstruct | MC8745
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 186 ± 27 aa |
| Standard deviation of domain lengths | 26.92 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 80.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.40 |
| Mean length-normalized TM-Score | 0.41 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 22.05 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0112 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X8QVR4 | 1-117 | MTKEEFLKQLDTALKSLPTEEREDIFRDYQEHFAIGLGEGKTEEKISASLGSPKQLAKELLASYHLEKVETAASIVNILSATYAVIG… |
| A0A1G9WRA2 | 1-176 | MNKDQYLKELKQRLAPLSKQDRDEILFDYQEHFDVGLQDGKSEIDIINELGTPHEAADNIMAEMSVPKQEERKSSSDHVRMVFLAII… |
| A0A5B8JSD9 | 31-204 | None |
| A0A316QCJ0 | 11-209 | None |
| A0A255IGR5 | 1-190 | None |
| R5TLS1 | 1-192 | None |
| A0A2U1E3R4 | 2-175 | None |
| A0A7C6J3Q0 | 1-203 | None |
| A0A355JEB3 | 3-196 | None |
| A0A1G9SDJ6 | 1-177 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.