DPCstruct | MC8742
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 97 ± 8 aa |
| Standard deviation of domain lengths | 7.69 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 88.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 37.47 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Z7KT75 | 15-108 | RELVRNAKQAQKTFATFSQEKIDSIVKHIATESARHAEELAKMANEETGFGKWQDKVLKNTFASVRVYEHIKDLKTVGIINDDKINK… |
| E6MI98 | 10-104 | SVQEVRKLLENAKQAQQKLAATDQQTADKIVKSIAEAGVRNARRLAQMAHEDTEFGVVDDKVIKNIFASRGVYEYIKDAKMMGEIDR… |
| A0A7K0F605 | 7-93 | None |
| A0A830HEF1 | 43-148 | None |
| A0A0L0JKF1 | 2-90 | None |
| T0CTC7 | 16-113 | None |
| A0A124F720 | 1-82 | None |
| A0A330LQL4 | 1-97 | None |
| G6ER70 | 40-134 | None |
| I3U822 | 13-110 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.