DPCstruct | MC874
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 185 ± 29 aa |
| Standard deviation of domain lengths | 29.35 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 83.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 23.90 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF09802 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A109UW46 | 22-192 | TKNVSVYTPLIYVSILIISLIVFANKYRKKKLEERSQLPSIFDEHNARDLYFELKELSETEKVHEKVMKAALLNRGAEAIRRTIKLK… |
| G7DUL6 | 16-224 | YVIVLFGGLSLFSKIYRRRAAASATYEPWYPPHHDRDIYVSLLSLEPPPQLPILVAALLRRAVFDVKLMWQNRETKQALNQLLLKGQ… |
| A0A370TMB4 | 2-178 | None |
| A0A1E5R881 | 25-195 | None |
| A0A420I761 | 10-201 | None |
| Q6C620 | 5-174 | None |
| U6JPL2 | 20-258 | None |
| A0A2N6P0L4 | 3-198 | None |
| D7FP83 | 46-241 | None |
| A0A4V3XGA6 | 61-243 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.