DPCstruct | MC8739
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 424 ± 22 aa |
| Standard deviation of domain lengths | 22.19 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 71.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 21.57 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W7KPE1 | 342-762 | KLFNYANNRVLHKIKAIEDAKKKINKVIRPTQYASSWLYVLVHLNNAWRHSDVVNFPRIEFKDTCIKSLTWIEENEISIDDAKNIVY… |
| A0A0C2V4Z2 | 1-376 | MVPIEIVGITDFNNFRLLSDEDAQVLVNEVFSRLERMKISKTGALGHFLVHGDMVAPTAIALTIAELHKREAKDDWLLRLYDRSHNI… |
| A0A854ZAY4 | 833-1242 | None |
| A0A6M1VR85 | 533-984 | None |
| A0A1Q9PTN3 | 1-448 | None |
| A0A1I3YFG9 | 204-635 | None |
| A0A0A3IQH4 | 64-474 | None |
| A0A2D1SVF9 | 454-863 | None |
| A0A0B5QKW1 | 174-621 | None |
| A0A0A3HRQ2 | 679-1109 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.