DPCstruct | MC8737
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 493 ± 55 aa |
| Standard deviation of domain lengths | 55.40 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 79.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.49 |
| Mean intra-cluster sequence similarity (%) | 14.55 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0320 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1L3MVK9 | 1-428 | MDERIKELVEFTRDKYGLGDYFLYDYELHRSMTIFKETVYTLRMDWFPNHEANWDDEESTPTGAACIEIDVHSKKPKSIIFVKGVSY… |
| A0A0C2QPL3 | 231-720 | RTKAIELARQRLGLSADYALDAARLVQLGDGEKRWNIAFMKKQGDSIAGSGEITLSAADGSVDWFTKSGAVSVPGLADKAQDAAAFK… |
| A0A0K9YL95 | 8-455 | None |
| A0A7T5JN77 | 69-563 | None |
| A0A845KZH8 | 52-626 | None |
| A0A0L0W8J2 | 21-529 | None |
| E0NKL0 | 44-503 | None |
| A0A1M5S0Z1 | 33-542 | None |
| A0A5C4SW88 | 465-992 | None |
| B2A850 | 36-639 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.