DPCstruct | MC8736
Metacluster Properties and Pfam Annotations
| Number of structural domains | 125 |
|---|---|
| Mean domain length (aa) | 287 ± 74 aa |
| Standard deviation of domain lengths | 73.90 |
| Length coefficient of variation | 0.26 |
| Mean AlphaFold2 pLDDT confidence score | 79.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 27.24 |
| Pfam Score | 99.12 |
| Assigned Pfam label(s) | PF00375- CL0227 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A645I6F2 | 2-175 | TVIYYFGFFTLYAYIAAGKKGISAFWRNALAPSVTAIATCSSAASIPINLVATKAIGVPKDTAETVIPLGANIHKDGSVFGGVLKVV… |
| A0A0C2QM49 | 20-324 | DGLGKEKQSTLGKLLVETEKRSDRTAEADGFNMKSFVSMLIPTNIFDALYHEKNLQVLFFSVVFGIGVGLIRSPASGHILAAGETIF… |
| A0A835NNJ4 | 207-520 | None |
| A0A347WI18 | 2-205 | None |
| A0A522CMV1 | 252-661 | None |
| A0A5J5CR95 | 36-439 | None |
| G1T525 | 53-354 | None |
| A0A158QUW3 | 572-943 | None |
| A0A7C1PWK5 | 74-413 | None |
| A0A3B4UV74 | 50-320 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.