DPCstruct | MC8735
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 141 ± 14 aa |
| Standard deviation of domain lengths | 13.99 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 68.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.40 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 27.67 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P8HQP6 | 1-128 | MMGERLRLCAACSLPSPGPTKRLYYQHRDYGPFFPILEEQRRKSNGYLFSGGRVVVCTGCASHLLRQWAFYEKNWTPLEKRTYTLLS… |
| H2ZR97 | 2-131 | VVCFVCGNMTAGSNVTQLFSRSQRTQQTPFFPFLEYHDPAPGASPMGDDWSVDACFVCDALLAQQWESFERGRMPIGKRLYWLKRPS… |
| B4IQK6 | 77-246 | None |
| A7RTU4 | 1-127 | None |
| A0A2I0TFS7 | 86-206 | None |
| S9YG61 | 42-161 | None |
| T1GMS3 | 1-155 | None |
| H3A1J6 | 3-150 | None |
| A0A182FA71 | 130-276 | None |
| A0A3Q0J9X3 | 25-151 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.