DPCstruct | MC8733
Metacluster Properties and Pfam Annotations
| Number of structural domains | 35 |
|---|---|
| Mean domain length (aa) | 195 ± 30 aa |
| Standard deviation of domain lengths | 29.85 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 83.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 29.38 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0113 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7R9B5M6 | 6-188 | SLTQDTNISPPHEYESMRRRIFNNVKSLWYLVSSRVTLLKKELSSMLPKLASRIASTLELAEEHERYLKNELSVMGEIDGFSAWREN… |
| H2ZQB8 | 13-231 | EMALKERNLYYMVIAGATACMLLSIFISSQLPPPEELPCDCTDYEISEEFLQQIQKMRKPSEVSRSTLERVVLTRKVRNDIKEMWNA… |
| A0A5J4N923 | 16-186 | None |
| T1F3C4 | 4-157 | None |
| A0A3Q0J8N4 | 29-204 | None |
| A0A7M3RV60 | 8-155 | None |
| A0A7J8JVG7 | 38-268 | None |
| A0A2A2KD97 | 58-296 | None |
| A0A183KUG8 | 2-169 | None |
| A0A0N0BIS4 | 52-283 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.