DPCstruct | MC8730
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 128 ± 3 aa |
| Standard deviation of domain lengths | 3.37 |
| Length coefficient of variation | 0.03 |
| Mean AlphaFold2 pLDDT confidence score | 79.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 27.61 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0273 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J8IWF0 | 101-228 | DIQEQVYHVQKLHHILEILVSCKLFIKPQHELLFSLTQSCIKYYKQNPLDEQHIFQLPVRPTAVKNLYQSEKPQKWRVEINSGQKKV… |
| H2ZLY8 | 3-134 | NRTMEGLRKLHHVTELATLCQANLMLPVEKIRSAVRSALQSYVAEEVNFHKLFSFDVSLTDVKWIIESSSPSVWRVNKLGANAFGED… |
| A0A401SWM3 | 632-761 | None |
| A0A7N9CFJ6 | 258-385 | None |
| A0A1Y1L4Y9 | 135-264 | None |
| F4WNA7 | 51-171 | None |
| A0A822GKP6 | 1-125 | None |
| A0A2J7RKR5 | 134-264 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.