DPCstruct | MC873
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 204 ± 23 aa |
| Standard deviation of domain lengths | 23.49 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 72.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.41 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 26.97 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0A2HW61 | 4-218 | YTEKQYDDDLTIVADEYDDSFHTDNVDLFEFPTYDESPLVRLKSLVLSIDWEITDDVLHQFNDELVDLKDVWADEKIYLVYIQALEK… |
| A0A0S7YP45 | 1-218 | MAPEKTGDSFAEEVEDRLENLFGEDEPEEESSAEAAETAGSPLRELKAIVLSIDWEITDEVMIRFVEQIAELQDAFKEDKVVLIFLQ… |
| S7TR30 | 47-275 | None |
| A0A445MRF4 | 1-213 | None |
| A0A660XE26 | 13-237 | None |
| A0A661JB59 | 69-225 | None |
| A0A7V4UND9 | 1-214 | None |
| A0A4U1AMZ1 | 4-173 | None |
| A0A7W0C9V1 | 1-198 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.