DPCstruct | MC8729
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 257 ± 42 aa |
| Standard deviation of domain lengths | 41.59 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 69.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 25.10 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14940 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| H2ZLV4 | 3-224 | TVAFISFAYYIQFNELQDPNNQKNWNIYLNNVSKINFCAQNYDAINSPQMDTNNTQNVSIPIMVISSISDPPATTLTGMYAIINGSL… |
| A0A7J6ZV35 | 7-246 | KNFVTNVKSKPPLVVFTVCLLGIIITTVCLTYYIQYQDEIPDDDAISDWISMLKHVNKLDLCSETSKPISAQDTLPRDGTTATISTP… |
| A0A2G8LFF2 | 16-244 | None |
| A7S4R2 | 48-322 | None |
| A0A2P2IC42 | 3-294 | None |
| A0A2J8J7L7 | 5-200 | None |
| S7PKJ9 | 91-370 | None |
| A0A498MWJ7 | 2-302 | None |
| A0A384AGI0 | 221-439 | None |
| A0A0R3TCU8 | 161-430 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.