DPCstruct | MC8727
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 97 ± 13 aa |
| Standard deviation of domain lengths | 12.89 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 82.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 37.33 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A212D6E1 | 131-223 | NNIPPVEFTLENPFCRFKAVGYSCMPNNKDEDGLVVLVFNKKETDIRSQQQQLVESLHKVLGGNQTLTVNVEGIKTLPDDQTEVVIY… |
| H2ZJL9 | 17-114 | FYKKDGAHVDFTPQNHFCRFKAVGFSCLPSAKDEDGLISLVCGKEEKEMLQIGKEKISGAIHKIIGGSPTISVQIDSIRSIPQDKTE… |
| A0A1I8I9U2 | 128-200 | None |
| A0A811VDU1 | 9-110 | None |
| A0A2J7PC90 | 237-328 | None |
| A0A3B5KXF7 | 88-181 | None |
| A0A5B7JKT4 | 4-89 | None |
| T1GKX4 | 232-344 | None |
| A0A0B1SJD8 | 17-115 | None |
| A0A673LWQ0 | 62-153 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.