DPCstruct | MC8726
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 210 ± 25 aa |
| Standard deviation of domain lengths | 25.03 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 85.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 32.36 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF08687 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Z2H4M1 | 232-439 | YYSTSAAKAQLLAQMKDFADDRERDEDDELGYKKQLMESLRKKLGVLREAQRGLQEDVRANGQLGDEVEGLVVAACTPSELDKFRMF… |
| H2ZIQ1 | 24-213 | IDPEDDNVEDINSKKVELVLSIKSKLCELESMKETLQVEMRENERLGGQVLTLVQRVCSDREQEKYNIFAHDVDKIINLLLSLSGRM… |
| A0A553MY56 | 337-522 | None |
| A0A6V7H230 | 579-795 | None |
| A0A7J8AX64 | 49-264 | None |
| A0A182W6S8 | 416-618 | None |
| S9XEU1 | 189-410 | None |
| A1Z9P3 | 1359-1571 | None |
| A0A0R3RM71 | 2-191 | None |
| S4RV80 | 2-178 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.