DPCstruct | MC8725
Metacluster Properties and Pfam Annotations
| Number of structural domains | 36 |
|---|---|
| Mean domain length (aa) | 136 ± 19 aa |
| Standard deviation of domain lengths | 18.95 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 70.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 37.31 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Y1MK37 | 25-135 | GNFVAKLYRGKNNHCLTNQLKKLFTYVEVAKPKCSRNSSIEAFVVCLGYIPNECKIENLQWFGDEPKNTVRFSICGEEDAFDSDSTY… |
| H2ZIK2 | 7-167 | LRYSEGKDVTLLYDQLRLFFTKVTCAKPRSSRNSSIEAFVVCENYTPPADYVPNMSNPLMDMNYDLYVNQLEGPNRVIAPFLACGDL… |
| A0A4Q4UDF5 | 2-159 | None |
| A0A484BT27 | 93-224 | None |
| A0A5E4B8G7 | 128-276 | None |
| A0A183B5G5 | 33-161 | None |
| A0A7R9TFG7 | 256-373 | None |
| A0A816J4A3 | 591-733 | None |
| A0A1D2NJU9 | 152-282 | None |
| A0A0N4XS87 | 5-118 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.