DPCstruct | MC8724
Metacluster Properties and Pfam Annotations
| Number of structural domains | 35 |
|---|---|
| Mean domain length (aa) | 261 ± 35 aa |
| Standard deviation of domain lengths | 35.25 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 75.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 29.94 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A822A5B5 | 1-205 | GEQVIHTSTFINQHPIIFWNLVWYFRRLDLPSNLPGLILTSEHCNGGEQVPQSSLSQDSKLVYIQLLWDNVNLHQDPGEALYMKWRT… |
| H2ZEE3 | 40-303 | NLPPQSPLSTKSSATEESHSTRMSIGDSQSELNSQIAPQILEPVTIPYLSSLVLRKELESLLENEGTKVLTDPGFVDNHPILYWNLV… |
| A0A1S3QQ30 | 288-532 | None |
| A0A834EK23 | 659-958 | None |
| A0A182EEI4 | 889-1119 | None |
| G0N031 | 164-412 | None |
| A0A6P4ZBY0 | 90-367 | None |
| A0A183J8F7 | 341-555 | None |
| A0A653C542 | 59-320 | None |
| A0A7J8BDK8 | 451-741 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.