DPCstruct | MC8723
Metacluster Properties and Pfam Annotations
| Number of structural domains | 3 |
|---|---|
| Mean domain length (aa) | 318 ± 31 aa |
| Standard deviation of domain lengths | 30.68 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 68.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 18.12 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0647 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2X0MLH4 | 1-276 | MMGGLFGTNTSTGLGGQQRLGLFGSTIQPQQQQQQQQQGGFQLATSTQQQQASTSSLNKMTKFNDLPENVRAVIEGIDSFVRQQVHL… |
| J9K2Y0 | 102-429 | LNLSFGSTATTAATTASPFSLGTTALNAKPTATLTGTQLTLGTTANVTTSAAPVSRGLGGLDTTSNINQAQNKAVPALEMPVPNEIL… |
| A0A1Y2GMB4 | 91-439 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.