DPCstruct | MC8720
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 103 ± 9 aa |
| Standard deviation of domain lengths | 9.11 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 80.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 40.36 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0465 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A834C0Q6 | 57-143 | GFETPLHFACKFGCPDVVNVLCSHPGIDKNCKNKDGLKPCDLICSRKNKTQEVKQRIEEYLEDRCYVPLLRATDNTSQPIIGDPWSP |
| H2Z5J9 | 1-107 | MACKFGFKAVVAELVCNPICNKTMQNKSHQTPAQVACSRASNKSEATKKEILALLEDQYYVPLMRCHDNSDRASVGHPWLPGSTEET… |
| A0A7E4RR45 | 208-314 | None |
| A7RY12 | 133-228 | None |
| A0A1L8I1A3 | 406-512 | None |
| A0NCF0 | 182-279 | None |
| A0A452T495 | 130-237 | None |
| A0A210QAM3 | 18-116 | None |
| A0A2R7X0W9 | 40-127 | None |
| A0A674EDT9 | 358-466 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.