DPCstruct | MC872
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 79 ± 9 aa |
| Standard deviation of domain lengths | 8.78 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 89.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 50.05 |
| Pfam Score | 92.86 |
| Assigned Pfam label(s) | CL0143- CL0550 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5B7JLY4 | 17-94 | LTISPSGFKSEWATVKDETLIVGGLGKEWTTSTGELVNHNPQWVKTITTRGNVEHFDWTKNYEKLREAVGIHFPGEMW |
| A0A368GB00 | 134-227 | NTTKGMKAEWLTIKDDLLYAGGHGREFQNDKGEVISEDPMWIKIITRKGEVKSKNWNKVFTRIRDAAGYPLPGYLTHEAVQWSDKLQ… |
| A0A493TTT7 | 354-432 | None |
| A0A5F4CEU9 | 207-279 | None |
| A0A3Q0IYZ1 | 194-261 | None |
| A0A368FD48 | 46-127 | None |
| A0A498M3M0 | 195-267 | None |
| A0A482R8Q3 | 126-203 | None |
| A0A183BN19 | 89-185 | None |
| A0A183CJH0 | 365-436 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.