DPCstruct | MC8719
Metacluster Properties and Pfam Annotations
| Number of structural domains | 255 |
|---|---|
| Mean domain length (aa) | 263 ± 54 aa |
| Standard deviation of domain lengths | 53.57 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 85.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 18.63 |
| Pfam Score | 98.03 |
| Assigned Pfam label(s) | PF08996- CL0509- PF14260- CL0194 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A453HJ11 | 47-299 | LPPESLYKTPSGEIFVKPELQKGILPEILEELLAARKRAKADLKEAKDPFERAVLDGRQLALKISANSVYGFTGATVGQLPCLEISS… |
| H2Z268 | 48-306 | PCLEISGSVTAFGRMMIDQTKRHVETQYTVENGYAHNAKVIYGDTDSVMVKFGVATVAESMALGKEAADLVSEKFVKPIKLEFEKVY… |
| A0A2I4D1N1 | 510-839 | None |
| A0A117IRL0 | 164-508 | None |
| A0A7X7VHV6 | 206-438 | None |
| A0A1R3KL87 | 30-333 | None |
| A0A1J3HQT6 | 2-204 | None |
| A0A5S6QH45 | 495-795 | None |
| A0A2N9ISQ6 | 840-1076 | None |
| A0A1I8IJM1 | 228-467 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.