DPCstruct | MC8718
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 159 ± 15 aa |
| Standard deviation of domain lengths | 15.38 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 75.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 25.10 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2Y9PHW0 | 3-152 | HLDVNLSYLESHYSSSGPEFKRVLFNFGGQSPLILYYLKMHELAGISKAPGQVKIKLTEILKEPPPAPTYCDILKEAKRQFANNQKD… |
| H2Z1I9 | 1-179 | QNVVTHNRGKQSNGGIQGKIFFQICQSNAVGRAAEFNRSVFNLNGRSPLLSEYLHQRGLDKVTGCDQLVRRTQIESLPSRQAPTYND… |
| K7F8X1 | 266-414 | None |
| A0A1S3FV42 | 273-443 | None |
| Q08EB1 | 10-181 | None |
| A0A4W3HBY4 | 226-351 | None |
| A0A1S3QN28 | 1-170 | None |
| A0A4W3K0G3 | 117-272 | None |
| A0A151M9H9 | 1-155 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.