DPCstruct | MC8717
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 114 ± 12 aa |
| Standard deviation of domain lengths | 12.46 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 87.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 39.15 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| H2Z0S8 | 15-135 | NCSRLNESLTVPVQYDIGSNDVVTSHTPPSVRDQAVPGFIHFRPYDPKGVPNALCPGVRSDSCRPSSICVGGINTNPGNSRTCGDFA… |
| A0A061I1B7 | 491-605 | PVKYGGGKCWTDNGPALPVVYDFGDAQKTASYYSPYGQKEFTAGFVQFRVFNNERAANALCAGMKVTGCNTEIHCIGGGGFFPEGNP… |
| A0A6B0SBW3 | 612-726 | None |
| A0A498L3W4 | 227-313 | None |
| A0A498LAB4 | 227-316 | None |
| A0A498LEE2 | 120-240 | None |
| C3ZLX9 | 121-237 | None |
| M1RBI1 | 275-388 | None |
| A0A6P6D6D2 | 192-301 | None |
| A0A0F8CMU8 | 370-498 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.