DPCstruct | MC8715
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 73 ± 8 aa |
| Standard deviation of domain lengths | 7.62 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 86.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 27.91 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P1J4A7 | 2-74 | NTISERALTRRISRALSREDASRLCRTRAGSRAELDLGEWYVLSARNIATSTHVDLQDLGRELGVLQSHEQIE |
| A0A5E7U404 | 1-73 | MNISERALIKRINRKLAHEGEVLRTARSYTVELGWYYVIDGVTSFPVTCQCDLEYLALELGVLHAGEALEKEV |
| A0A560L3F3 | 1-68 | None |
| A0A560KWT3 | 18-96 | None |
| A0A4R1PVL5 | 2-69 | None |
| I2IIP8 | 38-117 | None |
| A0A7G9SR93 | 7-68 | None |
| A0A4P7ZTE9 | 10-70 | None |
| A0A6L7ERF3 | 9-81 | None |
| A0A1F2S304 | 2-67 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.