DPCstruct | MC8712
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 98 ± 8 aa |
| Standard deviation of domain lengths | 8.18 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 92.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 34.36 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0014 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2G5X9R3 | 1-90 | MALVKARKEQDKPVFEICKGDQIMNVAFGGTLYQDIHAQLVDDLLQHNQLTDLEFATQLLDIVPDSILAEYAGASEIRVNTLHHQAV… |
| A0A3E0NUF0 | 351-449 | SRERDASEMALIRAAVEAGVPALCVCRGQQLLNVAFGGTLVGDIEREVGREIEHRSASGDPVLHEVEVGAGTLLSQVLGEASVTGSS… |
| A0A6C1PPT4 | 165-270 | None |
| A0A813A9B3 | 687-767 | None |
| A0A1I5X1D3 | 80-181 | None |
| A0A2H1KU32 | 51-149 | None |
| A0A6M8J8G0 | 573-660 | None |
| A0A3B9YF12 | 101-197 | None |
| A0A2E6KKK6 | 103-191 | None |
| A0A7X9CQ14 | 84-182 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.