DPCstruct | MC8711
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 65 ± 8 aa |
| Standard deviation of domain lengths | 8.03 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 82.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 40.46 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4P5YB60 | 10-72 | TCKGICVRYKAQKPVGTGRYASGQRRCQICEIFIKWEGLWCPCCGYRLRTKPRNLKYKAKLRA |
| A0A6A8MKV1 | 1-68 | MTCKGICVRYKAQKPVGTGRYASGQRRCQICEIFIKWEGLWCPCCGYRLRTKPRNLKYKAKLRARVEA |
| A0A0F9KL67 | 3-56 | None |
| A0A3N0A0H4 | 1-64 | None |
| A0A533WFK7 | 1-67 | None |
| A0A533WKE6 | 1-59 | None |
| A0A533WL77 | 1-60 | None |
| A0A3M9ZXE5 | 12-94 | None |
| A0A7D7ZGR6 | 2-60 | None |
| A0A533U5N1 | 25-82 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.