DPCstruct | MC871
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 73 ± 4 aa |
| Standard deviation of domain lengths | 4.03 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 79.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 36.42 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5H2XHS5 | 1-68 | MEAPSSLKTLCRYVETTLVPEDKILQFTIDKEVFGGERDTFLLPEDITQFAGMEEIGATVVAVYMRYL |
| A0A2P5D4I9 | 13-79 | VEIPAPLEVVVRYAEQALKDGQTISVPMPADIVGYEHTLIVLQEDIVQFGKLEEISATCIAIYLKSV |
| A0A2P5CGD2 | 110-185 | None |
| A0A314YPI4 | 80-155 | None |
| A0A2P6S2L3 | 100-171 | None |
| A0A5A7VLR9 | 101-176 | None |
| M5Y6K1 | 330-403 | None |
| A0A6J1DRE3 | 43-108 | None |
| A0A2H5QP87 | 18-87 | None |
| M5WEH7 | 226-304 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.