DPCstruct | MC8708
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 55 ± 6 aa |
| Standard deviation of domain lengths | 5.60 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 86.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 47.62 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12151 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0D0JYL1 | 3-53 | TFKVNIPAGPIWSQQDANEKAPLVAAAHQGKWTGQWNTVVDSQMSVVELEL |
| A0A0G1B4T6 | 18-80 | GISYGVFAALKTPLTALFAVNAGPLPNENTAKIICPLLCQSRGGTWTQQWKAGASGKAGFCFC |
| A0A2P1PZC5 | 69-121 | None |
| A0A539D9X4 | 97-149 | None |
| A0A0J8H0H4 | 192-242 | None |
| A0A0F5Y9D1 | 16-74 | None |
| A0A2D3RAK9 | 219-278 | None |
| A0A6S6U5A2 | 11-76 | None |
| A0A7W8D2X4 | 491-540 | None |
| A0A3D1P1D2 | 52-115 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.