DPCstruct | MC8706
Metacluster Properties and Pfam Annotations
| Number of structural domains | 118 |
|---|---|
| Mean domain length (aa) | 214 ± 55 aa |
| Standard deviation of domain lengths | 54.62 |
| Length coefficient of variation | 0.26 |
| Mean AlphaFold2 pLDDT confidence score | 81.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.47 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 24.10 |
| Pfam Score | 40.58 |
| Assigned Pfam label(s) | PF10585- CL0063- PF14732- PF08825- PF09358 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S3N745 | 107-346 | YNQLLKDLDPTTIKLDKSAFHPADFEKDDDSNFHIDFIHATANLRARNYRVVECDQLKTKMIAGKIIPAIATTTAMIVGAVGMELVK… |
| A0A0L0GDF3 | 2-194 | GENKDLDTDDAEHTTWLFQQALARAEQFNIKGVTYRLTKGVVKNIIPAVASTNSTIAACCANETFKLATRCNPHMNNYAFINLIDGV… |
| S4RDQ5 | 85-233 | None |
| T5AQS4 | 315-547 | None |
| A0A7J6PFX4 | 150-377 | None |
| A0A820H1T1 | 2-115 | None |
| A0A7S2URH7 | 19-266 | None |
| A0A7S1Y068 | 1-221 | None |
| A0A6A2XT78 | 122-380 | None |
| A0A6I9Y5R5 | 1-153 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.