DPCstruct | MC8704
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 111 ± 13 aa |
| Standard deviation of domain lengths | 12.76 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 78.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 45.25 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W2W3A1 | 1-98 | MLSKRPKDLYELWGEYEFGLNGLKPAKEFTAAERGANKFAYSRRKVFWDVVSAFVRTGFTSDVAIDKIYAAYGRQLSVTRILTALRT… |
| A0A0L0GAH7 | 313-407 | GNAQLSSKPKTLASLWEEYEIGIGTNKAAREFTQKERGSVRKTYSFRNSFWKAMETVMGRGNSVEEAMQKIQIAYGENASVTAVCRA… |
| A0A024TVX5 | 153-247 | None |
| A0A3R6V669 | 233-328 | None |
| A0A1E7ETZ7 | 418-547 | None |
| A0A6G0SME5 | 173-270 | None |
| V9ELU8 | 360-484 | None |
| A0A7S2KS93 | 631-742 | None |
| A0A7S4AS77 | 11-108 | None |
| A0A024TP94 | 1-122 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.