DPCstruct | MC8703
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 384 ± 71 aa |
| Standard deviation of domain lengths | 70.50 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 65.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.69 |
| Mean length-normalized TM-Score | 0.27 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 25.11 |
| Pfam Score | 94.12 |
| Assigned Pfam label(s) | CL0123- PF00057- PF09751 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0L0G440 | 3-359 | INLTPAYILNKILDEEEYNEGIDAIIEREFFPQVGRLRAENEYLDAKAENDVIGMRTIARKAAMARTLEGTPAASPHIRTPGALPSV… |
| A0A2W1I857 | 4-362 | SNSTALTKRSASNALMAPPPAPKRIKRPSVVLDEDTYVSAVSHIIRRDFFPGLAEADAQREYLNAVESKDKSWIREAGKKLTQVMTP… |
| A0A6V7WFI5 | 64-557 | None |
| A0A024G6A4 | 1-398 | None |
| A0A4T0REY8 | 9-466 | None |
| A0A4S2LSC4 | 31-326 | None |
| A0A0B2VYA4 | 285-609 | None |
| A0A672JVW1 | 57-280 | None |
| J4CCF2 | 52-469 | None |
| M7BWR3 | 185-495 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.