DPCstruct | MC870
Metacluster Properties and Pfam Annotations
| Number of structural domains | 91 |
|---|---|
| Mean domain length (aa) | 112 ± 18 aa |
| Standard deviation of domain lengths | 17.96 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 76.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 35.86 |
| Pfam Score | 65.21 |
| Assigned Pfam label(s) | PF00082- CL0004- CL0271 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0B2SIG9 | 2-104 | DTITKVLPEECVATIISLTSAKDACQLSPVSPSLKAIADSDAVWANFLPSDCEDIIDQSSTPTLNLLSKKQIYAHLCDYHVLFDNGN… |
| A0A2P5CRT2 | 3-107 | GEMSSEVNILDLPEDCISHILSLTSPGDVCRCATVSTKFRRAAQSDVVWNQFLPSCLEEILSGSAFASKKDLYFQLCGSGILIDGGN… |
| A0A0D3C8N4 | 154-271 | None |
| A0A1R3K7Z7 | 2-73 | None |
| A0A7N2L687 | 1-109 | None |
| A0A6P5GVG3 | 3-108 | None |
| A0A1R3J0G4 | 138-265 | None |
| A0A5S9YDS2 | 6-138 | None |
| A0A6A3B246 | 23-115 | None |
| A0A2K2DQ93 | 3-118 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.