DPCstruct | MC87
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 257 ± 31 aa |
| Standard deviation of domain lengths | 30.82 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 77.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 18.27 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF18686 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3A6UKC6 | 8-257 | KNPIKRALQGELLQDEPFIQLCTKIENYLMDTEAVNEQLIELNEQLTMRLKEKGLKPGEKGATKQLRTLIQEILTEAGFREGMLQTI… |
| A0A0W1A5P3 | 102-367 | KNTLLFKSINTLLELKVAGISIEDDYLYDFLTISNKLSDNEFFTKGMDHLETELQKYALNNPLFNLETHRERFFLPKPKTEKPYDRQ… |
| A0A0W0ZBF5 | 60-295 | None |
| A0A5E4PFY3 | 8-254 | None |
| A0A7W8WJT0 | 1-273 | None |
| A0A1E4ZHS4 | 183-438 | None |
| A0A1E4ZHM2 | 239-507 | None |
| A0A0W0ULE7 | 8-257 | None |
| A0A7U1HNP5 | 4-258 | None |
| A0A4Q6X4P3 | 8-262 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.