DPCstruct | MC8699
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 118 ± 11 aa |
| Standard deviation of domain lengths | 10.69 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 72.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 43.05 |
| Pfam Score | 96.88 |
| Assigned Pfam label(s) | CL0123- PF04855 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| E4Z0J8 | 7-117 | WKFWGSPPKPFQKGTSLFYLGSDVGNYLRMFRNKLYDKFPKLTVEKLDESDVSGLFSQTSEKHHKHVRIGAKIVLQQEIDELFATGG… |
| A0A0L0FTI5 | 4-117 | YDQEFVVPEPRRFRFGAEGDVFMLMNQATRFLSKPAGGLLSYHPGLWSRKTTFPERSQLIDQGLVQAESTCVTLVLADEIDEIIKDS… |
| B4E117 | 1-134 | None |
| A0A7R9LT14 | 11-106 | None |
| A0A0D8X6R3 | 4-106 | None |
| T1KTW1 | 1-114 | None |
| A0A183KMU8 | 26-156 | None |
| A0A7R9FP31 | 3-108 | None |
| A0A0K8R858 | 3-129 | None |
| A0A2I4AL29 | 6-123 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.