DPCstruct | MC8698
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 151 ± 27 aa |
| Standard deviation of domain lengths | 27.44 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 87.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 21.19 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Q3XD31 | 187-316 | YTVMLDCYEHGGQVWSVTGSGPQCLFDTARGAGVWVPDQCLREELDSIKTNEGIDAARSRAVEFARQALGSYNAWLAGDCYGVAVDV… |
| A0A2W7NM42 | 7-172 | GLRMTMAVQSKPRNPRLADNNLFRIVTWTKGLGDPHPFHDRVEFHSRIPTRQYLIYRLRLNTDQTGRSSLSAMQGDMAPTAGYAFAD… |
| A0A1G3M1B6 | 92-236 | None |
| A0A7V5R8C8 | 5-215 | None |
| A0A252CF74 | 80-211 | None |
| A0A5C7PGN1 | 63-204 | None |
| A0A0F9H403 | 22-174 | None |
| A0A5D3I6D1 | 132-270 | None |
| S9QET8 | 40-193 | None |
| A0A355JFC3 | 12-185 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.