DPCstruct | MC8696
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 105 ± 17 aa |
| Standard deviation of domain lengths | 17.36 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 77.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 34.73 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2S7NZ09 | 2-86 | FTATADLHHNGICVNTGSGQNVYNSAATEAACTNYRYRNTGSKWWDTCPDCHMVNTGSPYCRTDAGHMGGDEITYYCKLHGADNA |
| B6HPU3 | 17-102 | ADLHTQGVCIDTPGDGVEVYNRAATEKACTAYKNRNTGSKQWDTCPDCTLLNEKDLLYYCESKGSHIGGDELNYYCKQNGAGDSVA |
| N1J7Q0 | 1-106 | None |
| A0A1V6YLN2 | 45-161 | None |
| A0A4T0VGU4 | 1-107 | None |
| J3PGN7 | 93-193 | None |
| A0A0J9VRV2 | 60-182 | None |
| A0A139IGQ4 | 13-88 | None |
| A0A1L7X8H1 | 1-117 | None |
| A0A4V6TBX0 | 19-141 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.