DPCstruct | MC8695
Metacluster Properties and Pfam Annotations
| Number of structural domains | 122 |
|---|---|
| Mean domain length (aa) | 301 ± 51 aa |
| Standard deviation of domain lengths | 50.62 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 73.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.33 |
| Mean intra-cluster local Distance Difference Test score | 0.44 |
| Mean intra-cluster sequence similarity (%) | 15.80 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0271 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3M7MDL0 | 22-309 | PTTAAPPAVVVPILSLPIELIRHVNTYLDTATAASFCLSSRYIYYALGTDVLTRHIDSSKNRFEKRRIIEAVVERAFPGHWFCAWCD… |
| B6HP41 | 1-335 | MVTTRDPAALTDLPLELLWMISEHLSLVDLACLALGNHRLLSSLAGTAFRDFTNTNGRNGNPTDDARIKLLSRLSRDLPQYYLCFIC… |
| A0A178AAH9 | 8-204 | None |
| A0A2J6TWQ3 | 161-500 | None |
| A0A1J7IX94 | 77-279 | None |
| A0A0C3DDX2 | 82-419 | None |
| A0A093X063 | 3-263 | None |
| A0A5N5PDM9 | 5-259 | None |
| A0A3M7DHJ4 | 507-809 | None |
| T5BCC9 | 1-300 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.