DPCstruct | MC8693
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 194 ± 26 aa |
| Standard deviation of domain lengths | 25.67 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 73.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 30.38 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A423WNH6 | 7-201 | FPPAPHDFFKFHEHRQWPAWKFDMAMEDLFDTLPQEYNSITIPILDRDAFRHDVQEIAHRAQDRPEFNRLLAERMKTRREEMVDLWC… |
| B6H8J3 | 1-221 | MAKRWQRTKDTHLRDHTPHLHPQKYDKEEKFHWEAGKVGYEDSNVLFTTLHDEYNSFKCAISDPEAWHFDVADVAKTANNNDEFLAL… |
| A0A194VQ58 | 15-217 | None |
| A0A194WAU9 | 2-196 | None |
| A0A1V6SCE7 | 2-214 | None |
| A0A420NC31 | 2-165 | None |
| A0A423VGT5 | 29-241 | None |
| J3P4I0 | 11-169 | None |
| A0A420PUM9 | 3-193 | None |
| T5A6I8 | 4-180 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.