DPCstruct | MC8692
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 125 ± 12 aa |
| Standard deviation of domain lengths | 12.32 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 82.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 25.18 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W6Q726 | 7-137 | PSVYKSTNGQYFAEPAGDRSDYYWITVYFSENIDHRGIPDSEIMLYVRDMIEKGRFTIDDQSMHGLGKKCLSIPIKRDPDTPLPKSW… |
| B6H0G9 | 49-160 | DRCPFMARERLVDPEDDAALWVTIEFPEAMKFTHTDEQLMDWVVHQIGHAETSTSASAQHYQRHLCLSLPVVGIPRGEEHNDAVRDQ… |
| A0A0A2L2A4 | 3-118 | None |
| A0A135LXA5 | 52-172 | None |
| A0A1V6Z6H2 | 1-113 | None |
| A0A0A2IVF3 | 115-244 | None |
| A0A1V6U8D1 | 2-140 | None |
| A0A1V6PXZ8 | 6-112 | None |
| W6QGL1 | 100-219 | None |
| A0A1V6NEW8 | 302-435 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.