DPCstruct | MC8690
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 124 ± 18 aa |
| Standard deviation of domain lengths | 18.14 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 85.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 29.48 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6G0U403 | 172-271 | PILGGMSAAEINSQFLNKHHKSLPALVQGLKMKYKLDNSTQQEVLDQITKLDDSLENVNIQTCTDILNSLINGEFGEVGDVAEEYRK… |
| G3HGT7 | 1-123 | MKKIFVNKDLQRFNEDFLIHNATSLQHLLSGAKMMYFLDKSRQEKAIAIATRLDETIKDKNVKTLTKVSEALLDGSFGNCSSQYEEY… |
| A0A6A4UZG9 | 65-189 | None |
| A0A2B4RKX4 | 27-149 | None |
| A0A4C1TGD6 | 142-272 | None |
| B7P5N3 | 167-275 | None |
| A0A7R9GY88 | 238-354 | None |
| A0A5D2QE77 | 5-173 | None |
| T1HB37 | 1-118 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.