DPCstruct | MC869
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 100 ± 9 aa |
| Standard deviation of domain lengths | 9.03 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 74.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 42.88 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A368S1C2 | 1-102 | MQCEVVIFDEKPSFSELLARAREELHCHEDDKITVEGILHLGSPLNIQRKMVPIRCAGQWEKYVRTVMNGHSPSVEVVVRRVGVDPN… |
| A0A835E0Z0 | 71-168 | RMFEVAPCLHEIVECAWSHFSCGVDDEISLKGGVDCDRGRAAYALVYLKTDVEWDQFKRLVEQSSVPYLDVVVTSRKTADREGESAD… |
| A0A835FLC2 | 6-108 | None |
| B9FYD5 | 64-173 | None |
| A0A834ZZH3 | 82-188 | None |
| A0A835CDK7 | 7-88 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.