DPCstruct | MC8686
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 75 ± 12 aa |
| Standard deviation of domain lengths | 12.17 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 66.23 |
| Mean fraction of residues predicted as intrinsically disordered | 0.45 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 35.63 |
| Pfam Score | 88.89 |
| Assigned Pfam label(s) | PF06817- CL0010- CL0219 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q2HHY7 | 263-328 | LPLQSRVRVWREKSRRWEGPFTLIGVHDEDCIVETSRGAQKFRSTVVKPYYEDPAQQDDPANQKDT |
| G3GXW0 | 1-91 | MSNLLQIDSGIQATFAQVKWKDHCTGLQKGPDPVLIWGRGHVCLFFSQEENEVQWLPECLVRCVEQSKANPDGAVTAGPPPEELEQD… |
| A0A6P9D050 | 1-100 | None |
| A0A3M0IT78 | 111-195 | None |
| A0A3M0IRU0 | 911-975 | None |
| A0A3M0IR00 | 35-107 | None |
| A0A3M0L9B8 | 325-394 | None |
| A0A3M0L1Q8 | 383-450 | None |
| A0A3M0KJP4 | 188-258 | None |
| A0A3M0L9E6 | 267-326 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.