DPCstruct | MC8685
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 120 ± 17 aa |
| Standard deviation of domain lengths | 16.71 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 79.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 27.44 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0351 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A3KNX4 | 14-108 | LSRQNGRPALKATKPLVLKNEVPMRKMTKGEATCVTEMSLLMACWKQNDFNNAFCPQEVTAFYTCVEKAKMRNQGRKAGRLLPEEVN… |
| G3GWP3 | 122-240 | TPQSLLGTCAKWRHPVCALGWRGLRTLNPNKPLILANRVGNRRREKGEATCITEMSMMMACWKQNEFRDEACRKEIQDFFDCSSRAQ… |
| A0A2A2KHX2 | 77-236 | None |
| A0A6J0TIF8 | 7-125 | None |
| A0A1I7Z0L7 | 84-201 | None |
| A0A7J7IW72 | 9-123 | None |
| A0A3M6UFA0 | 39-142 | None |
| A0A212EJV5 | 1-96 | None |
| A0A0N5ABH2 | 10-123 | None |
| A0A7M5WQJ0 | 5-113 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.