DPCstruct | MC8684
Metacluster Properties and Pfam Annotations
| Number of structural domains | 49 |
|---|---|
| Mean domain length (aa) | 83 ± 5 aa |
| Standard deviation of domain lengths | 5.48 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 90.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.94 |
| Mean intra-cluster local Distance Difference Test score | 0.93 |
| Mean intra-cluster sequence similarity (%) | 55.20 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0N4YTV2 | 222-305 | TPPPQYYKDAENPPYNYYLFYMYANLTALNAFRRERGMSTFSLRPHCGEAGHVNHLLTGFLTSESIAHGILLRKVCFCWLHIYL |
| A0A452YWX7 | 1-86 | MPTPEEWTNVFNPAFSYYAYYCYANLYTLNKLRESKGMNTIKFRPHAGEAGDVDHLAATFLLCHSISHGINLRKSPVLQYLYYLGQ |
| A0A445CCQ7 | 1-75 | None |
| A0A819Q589 | 417-490 | None |
| A0A0G4HGK4 | 521-597 | None |
| A0A226ETE9 | 753-832 | None |
| A0A1I8FIS9 | 188-267 | None |
| A0A7S1MNL8 | 3-82 | None |
| A0A7S1Q2P0 | 321-399 | None |
| A0A086JZI8 | 324-409 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.