DPCstruct | MC8682
Metacluster Properties and Pfam Annotations
| Number of structural domains | 48 |
|---|---|
| Mean domain length (aa) | 164 ± 46 aa |
| Standard deviation of domain lengths | 46.21 |
| Length coefficient of variation | 0.28 |
| Mean AlphaFold2 pLDDT confidence score | 81.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 28.94 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF16413 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A162YHL8 | 163-263 | AIGSPISLHQCLSLEYHENETHAIALDLYAKSDILAQHFKTDLVMEDGIIWLKSLPLIIRNYVPTLEKIPMFIHRLSTKINWESETE… |
| A0A833ZWR8 | 25-170 | IVEFLKKKSEMLADYFSLEIDEEGNLVGLPLLIDNYVPPLEGLPIFILQLATEVNWDEEKECFESLSKECAMFYSVRKQYISEESTL… |
| A0A7R8XAI6 | 985-1155 | None |
| A0A1Q9CDV1 | 263-461 | None |
| F4PI82 | 676-978 | None |
| A0A1V8SMQ6 | 51-216 | None |
| A0A822XX88 | 268-484 | None |
| G4ZIL0 | 88-236 | None |
| A0A287HQM8 | 38-213 | None |
| A0A662Y2N1 | 920-1072 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.