DPCstruct | MC8681
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 172 ± 16 aa |
| Standard deviation of domain lengths | 15.98 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 73.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.43 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 49.35 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11315 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7N9AL64 | 2-156 | LTRDVNTASLCRIGQETVQDIVLRTMEIFQLLRNMQLPNGVTYHPNTHQDRLGKLQEHLRTLSVLFRKLRLVYDKCNENCTGLDLIP… |
| A0A833ZUF6 | 2-147 | STPPLAASGMAPGPFAGPQAQQAAREVNTASLCRIGQETVQDIVYRTMEIFQLLRNMQLPNGVTYHTGTYQDRLAKLQDHLRQLSIL… |
| A0A6G0TW39 | 36-220 | None |
| T1JD32 | 27-215 | None |
| A0A821FFQ5 | 37-221 | None |
| E9GFJ8 | 21-185 | None |
| A0A5E4QBB3 | 73-250 | None |
| A0A669AVK1 | 2-181 | None |
| A0A1A8QVL1 | 1-135 | None |
| H2M2P1 | 7-178 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.