DPCstruct | MC868
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 100 ± 12 aa |
| Standard deviation of domain lengths | 12.48 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 80.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.40 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 61.59 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01165 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5D2KZ82 | 1-78 | MRGIRVKVRNGNLEQALAVMQRVMQSSGIERLIKQEQTHHIKNSEKRILARKILERKIKSQDHARKLQTILIKKVRGL |
| A0A835B1B9 | 9-106 | RGIAAAVRPSAMDAGHGRQLQQARGIVVQVRDGNLDRALSIMERKMRSSGIERLIRARTHHHVKDSEKRVLARKALMQRVKSQELGK… |
| A0A444ES02 | 288-396 | None |
| A0A1Q3C3U3 | 9-106 | None |
| A0A7J7H141 | 128-234 | None |
| A0A6V7PNN2 | 68-156 | None |
| A0A445J5P1 | 11-109 | None |
| K4AEG7 | 117-230 | None |
| A0A835JPW0 | 14-112 | None |
| A0A7C9DWU9 | 54-160 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.