DPCstruct | MC8679
Metacluster Properties and Pfam Annotations
| Number of structural domains | 5 |
|---|---|
| Mean domain length (aa) | 201 ± 15 aa |
| Standard deviation of domain lengths | 14.69 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 72.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 23.36 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF09733 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A267G2X8 | 403-597 | HSGTAKQSAGSKSGAGGDWRVIYNFYHAGRCRQCTEVDGLRCPWCDLDCRQANGLLCHLRACHSRLAFASISETSAVKRRRLLLEVR… |
| A0A833ZPB5 | 1-198 | MYKLELCFFCLFVLKFLYNNNTRQQTEARDDLHCPWCTLNCRKLYSLLKHLKLCHSRFIFNYVYHPKGARIDVSINECYDGSYAGNP… |
| A0A814EED4 | 266-478 | None |
| C9SE44 | 44-263 | None |
| A0A1X7UKC7 | 536-713 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.