DPCstruct | MC8676
Metacluster Properties and Pfam Annotations
| Number of structural domains | 169 |
|---|---|
| Mean domain length (aa) | 246 ± 51 aa |
| Standard deviation of domain lengths | 51.01 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 81.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 33.16 |
| Pfam Score | 96.45 |
| Assigned Pfam label(s) | CL0031- CL0229- CL0266- PF12578 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A670ZXH0 | 306-460 | SRWLSNVESTHWLEYIRMLLAGAVRIADKIESGKTSVVVHCSDGWDRTTQLTSLAMLMLDSYYRTIKGFEVLLEKEWMSFGHRFAMR… |
| A0A833ZED3 | 19-259 | SHWLSSLESTHWLEHIKLVLTGAIQVADKVSSGKSSVLVHCSDGWDRTAQLTSLAMLMLDSFYRSIEGFEILVQKEWISFGHKFASR… |
| A0A6P8IBS5 | 460-726 | None |
| M2RDT6 | 694-912 | None |
| A0A3Q0IYJ0 | 81-251 | None |
| A0A7R9KGB5 | 342-561 | None |
| A0A6I8PLV7 | 269-513 | None |
| A0A0M8MY17 | 768-1199 | None |
| A0A6P4EEV9 | 412-704 | None |
| A0A4W4DXH8 | 267-527 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.