DPCstruct | MC8675
Metacluster Properties and Pfam Annotations
| Number of structural domains | 41 |
|---|---|
| Mean domain length (aa) | 618 ± 115 aa |
| Standard deviation of domain lengths | 115.37 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 75.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 19.32 |
| Pfam Score | 83.51 |
| Assigned Pfam label(s) | CL0023- CL0154- PF16172- CL0010- PF11878 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A653CCL7 | 2-529 | VEPDSMSVVELYHVHVSSAENTQGVSARGTIKKKEQKKTLTHHLYFCMRDFGHHVGEDTEIYFSLYDSGKQKYLTERFLVKISKEGF… |
| A0A833ZD43 | 261-974 | EEWLITLKKIIQINTDSLVQEKKETAETTQDDETSSQGKAENIMASLERSMHPELMKYGRETEQLNKLSRGDGRQNLFSFDSEVQRL… |
| A0A7J7F2M1 | 303-899 | None |
| L8GS36 | 295-934 | None |
| A0A139AY66 | 232-860 | None |
| A0A3P7M2E5 | 18-497 | None |
| A0A674K5X6 | 38-578 | None |
| G1Q020 | 1-566 | None |
| A0A044SZE1 | 346-925 | None |
| A0A653D309 | 84-798 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.