DPCstruct | MC8674
Metacluster Properties and Pfam Annotations
| Number of structural domains | 74 |
|---|---|
| Mean domain length (aa) | 176 ± 33 aa |
| Standard deviation of domain lengths | 32.91 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 82.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.64 |
| Mean length-normalized TM-Score | 0.44 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 40.04 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0004 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S1FYC3 | 144-317 | LEEKEIKDPAVSKPEDWIDEKKIPDPNDVKPEGYDDISPEVPDSDASKPEDWDDEDDGEWEPPMIPNPDYNGPWRQKQIDNPEYKGE… |
| A0A833ZA33 | 5-183 | FCHPRRSRILMLQSPKTGMSGPKLMTPQTLNLRLDWDKPEHIPDPDAKKPEDWDEEMDGEWEPPVIQNPEYKGEWKPRQIDNPDYKG… |
| K3XDL1 | 112-229 | None |
| A0A811QY81 | 224-461 | None |
| T1EF60 | 298-556 | None |
| A0A556U1S5 | 125-306 | None |
| A0A0B1PS05 | 948-1136 | None |
| A0A085NTG2 | 864-1061 | None |
| A0A367LK18 | 631-863 | None |
| A0A5J5A8L9 | 896-1086 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.