DPCstruct | MC8673
Metacluster Properties and Pfam Annotations
| Number of structural domains | 89 |
|---|---|
| Mean domain length (aa) | 192 ± 46 aa |
| Standard deviation of domain lengths | 45.68 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 81.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 21.91 |
| Pfam Score | 99.04 |
| Assigned Pfam label(s) | CL0479- PF03981 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A833Z962 | 28-213 | SPTQGRWGRPLFGTSQKIKIAALRMYTSCVKKTDFEEFFLRCQMPDTFNSWFLITLLHVWMCLVRMKQEGRTGKYMCRIIVHFMWED… |
| A0A4D9CTH2 | 3-175 | RTRNSEALLQSCISQAGNTIFYRAGRVSDSFRAAHGLLIVHVWMLHKRLLMEGEEGKILEEALFDRLWDETTARIRALKVNELSVNS… |
| A0A2A4QRR3 | 1-138 | None |
| A0A1Q4DQJ8 | 2-159 | None |
| A0A6D2I8P3 | 40-283 | None |
| A0A3B4V2D5 | 11-169 | None |
| M1VM44 | 75-283 | None |
| A0A061DD38 | 61-314 | None |
| A0A7L5Y0L5 | 9-147 | None |
| A0A066VV10 | 52-362 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.